KEGG   Enterobacter sp. R4-368: H650_20745
Entry
H650_20745        CDS       T02700                                 
Name
(GenBank) multidrug ABC transporter ATP-binding protein
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
enr  Enterobacter sp. R4-368
Pathway
enr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:enr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    H650_20745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enr02000]
    H650_20745
Transporters [BR:enr02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    H650_20745
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 AAA_29 nSTAND3 RsgA_GTPase MMR_HSR1 DUF87 AAA_25 AAA_33 DEAD NB-ARC
Other DBs
NCBI-ProteinID: AGN87455
LinkDB
Position
4198625..4200403
AA seq 592 aa
MRNFTKQWPTLKRLLKYGSPWRKPLAKAVLMLWVAAIAEVSGPALISYFIDNMVAKNYLP
LGMVAGMAAVYVGLQLLAALLHYAQALLFNQAAVGVVQQLRTDVMDAALRQPLSAFDTQP
VGQIISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAMFSLDWRMALVAMAIFPAVLI
VMLLYQRYSTPIVRRMRAYLADINDGFNEIINGMSVIQQFRQQARFGERMSESSRSHYIA
RMQTLRLDGFLLRPLLSLFSALVLCGLLMLFGFSSVGTVEVGVLYAFISYLGRLNEPLIE
LTTQQSMLQQAVVAGERVFELMDRPRQTYGYDDAPLQSGSIDIDNLSFAYRDDQLVLQDI
SLHVEPRSFVALVGHTGSGKSTLASLLMGYYPLTKGEIRLDGRPLSALGHAPLRKGVAMV
QQDPVVLADSFYANVTLGREISEEQVWKALETVQLAELARTMSDGIYTRLGEQGNNLSVG
QKQLLALARVLVDTPQILILDEATANIDSGTEQAIQHALAAVREHTTLVVIAHRLSTIVE
AETILVLHRGQAVERGTHQQLLEAKGRYWQMYQLQLAGEELAASAREESLIA
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgcgtaatttcaccaaacagtggccaacgctgaaacgcttgctgaaatacggctcgccg
tggcgcaaaccgttggctaaagcggtgctgatgctgtgggtcgcggcgattgccgaagtc
tccggcccggcgctgatcagctactttatcgataatatggtggcgaaaaactatctgccg
ctcggcatggttgccgggatggcggcggtgtatgtcggcctgcaattacttgcggccctg
ctgcattatgcgcaagcgctgctgtttaaccaggcggcggtcggcgtggtgcaacagttg
cgtaccgatgtgatggatgccgccctgcgtcagccgctcagcgcgtttgacacccagcct
gtcgggcagattatttcgcgcgtgaccaatgatactgaagtgatccgcgatctctacgtc
acggtggtggcaacggtgttgcgcagcgcggcgctgattggcgcgatgctggtagcgatg
tttagcctcgactggcgcatggcgctggtagcgatggcgattttcccggcggtgctgata
gtgatgctgctttaccagcgttacagcacgccgattgtgcggcgcatgcgtgcttatctg
gcggatatcaatgatggtttcaacgaaatcatcaacgggatgagcgttattcagcagttt
cgccagcaggcgcgttttggggaacgaatgagcgaatccagccgttcgcactatatcgcc
cgcatgcaaaccctgcggctggacggctttttgctgcgtccgctgttgagccttttctcc
gcgctggtgctgtgtggcttgctgatgctattcggtttctcgtccgtaggcacggtagag
gttggggtgctgtatgccttcatcagctatctcgggcgtcttaacgagccgttgattgaa
ctgacaacgcagcagtcaatgctgcagcaggcggtagtcgccggtgagcgcgtgttcgag
ctgatggacaggccgcgccagacttacggctatgatgacgcgccgctgcaaagcgggtct
atcgatatcgacaatctctcttttgcttaccgcgacgatcaactggtgctgcaggatatc
tccttgcacgtggagccgcgcagttttgtcgcgctggtcgggcacaccggcagtggcaaa
agtacgctggccagcctgttaatgggctattacccgctgacgaaaggggagatccgtctg
gacgggcgtcctctgtctgcattagggcatgcgccgctgcgcaaaggtgtggcgatggtg
cagcaggatccggtagtgctggcggacagcttctacgctaacgtgacgctggggcgtgaa
atcagcgaagaacaggtgtggaaagcgctggaaacggtgcagttagctgagctggcgcgc
acgatgagcgacggtatttacacacgattgggcgagcagggtaataacctctcggtgggg
caaaaacagctgctggcgctggcgcgcgtgctggttgatacgccgcagatcctgattctg
gatgaagcgacagcgaacatcgattccggcaccgaacaggcaattcagcacgcgctggcg
gccgtgcgtgagcatacgacgttggtggtgatcgcccaccgtttatcgaccattgttgag
gcagaaacgattctggtgctgcatcgcggccaggcggttgagcgcggtactcatcagcaa
ctgcttgaagcgaagggccgttactggcagatgtatcagttacagcttgccggtgaggag
ctggctgccagcgcgcgcgaagagtcgcttatcgcctga

DBGET integrated database retrieval system