Enterobacter sp. R4-368: H650_22375 Help Entry H650_22375        CDS       T02700                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism enr  Enterobacter sp. R4-368 Pathway enr00190   Oxidative phosphorylation enr01100   Metabolic pathways enr02020   Two-component system Module enr_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:enr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     H650_22375  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     H650_22375 Enzymes [BR:enr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      H650_22375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AGN87769 LinkDB All DBs Position 4538040..4538153 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGVITALALEHVEATKAGKEEH NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattttaggaacgcttcttgcctgtgctttcggagtgattacc gcgctggcgctggaacatgttgaagcgaccaaagccgggaaagaagaacactga

DBGET integrated database retrieval system