Enterobacter sp. R4-368: H650_24565 Help Entry H650_24565        CDS       T02700                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism enr  Enterobacter sp. R4-368 Pathway enr01100   Metabolic pathways enr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H650_24565 (acpP)    00074 Mycolic acid biosynthesis     H650_24565 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H650_24565 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AGN88186 LinkDB All DBs Position 4988597..4988833 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system