Enterobacter sp. DSM 30060: HWQ15_06640 Help Entry HWQ15_06640       CDS       T07983                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ens  Enterobacter sp. DSM 30060 Pathway ens01100   Metabolic pathways ens01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ens00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWQ15_06640    00074 Mycolic acid biosynthesis     HWQ15_06640   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWQ15_06640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QLA01798 LinkDB All DBs Position 1383295..1383552 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLEELTPEDIDTDAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESDEMRQHFYSVATLAAFIHQQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaagaatctcattatctctacgctgaatctggaagaa cttaccccagaggatattgatacagacgccgcgctctttggcgacggcctcggtctggac tcaatcgacgcccttgagctggggctggcggtaaaaaatcagtacggcgtagtgctttct gccgaaagtgacgagatgcgtcagcacttctattccgttgccacgctcgcggcttttatt catcaacaacgcgcctga

DBGET integrated database retrieval system