Enterobacter sp. 638: Ent638_3886 Help Entry Ent638_3886       CDS       T00507                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ent  Enterobacter sp. 638 Pathway ent01100   Metabolic pathways ent01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ent00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ent638_3886    00074 Mycolic acid biosynthesis     Ent638_3886   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ent638_3886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABP62541 UniProt:  A0A9J9GJG8 LinkDB All DBs Position 4195675..4195935 Genome browser AA seq 86 aa AA seqDB search MMQALYLEIKNLIISTLNLDELTADDIDADAALFGDGLGLDSIDALELGLAVKNQYGVVL SAESEEMRQHFYSVATLASFIHAQRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgatgcaagcgctttatcttgaaattaaaaatcttattatctctacgctaaatctggac gaactgaccgcagacgatatcgacgcggatgcggcgctgtttggcgatggtctgggcctc gattctatcgatgcactggaactgggtctggcagtcaaaaaccaatatggcgtagtgctt tctgcggaaagcgaggagatgcgtcagcatttttattccgtcgccacgctggcatcattt atccatgcccaacgcgcctga

DBGET integrated database retrieval system