Enterobacter sp. LU1: FZF21_01530 Help Entry FZF21_01530       CDS       T11438                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism entl  Enterobacter sp. LU1 Pathway entl01100   Metabolic pathways entl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:entl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FZF21_01530 (acpP)    00074 Mycolic acid biosynthesis     FZF21_01530 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FZF21_01530 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QEL46134 LinkDB All DBs Position 1759000..1759236 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttcctttgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system