Enterobacter sp. YSU: H2Z33_09660 Help Entry H2Z33_09660       CDS       T11024                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism enty  Enterobacter sp. YSU Pathway enty01100   Metabolic pathways enty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enty00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H2Z33_09660    00074 Mycolic acid biosynthesis     H2Z33_09660   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H2Z33_09660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 MerR_2 Motif Other DBs NCBI-ProteinID:  QPX99551 LinkDB All DBs Position complement(2010631..2010882) Genome browser AA seq 83 aa AA seqDB search MTEQQTIYQEVSALLITLFEIAPEDITPEARLYEDLDLDSIDAVDMVVHLQKKTGHKIKP ETFKAVRTVQDVVDVVEQLQRDA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacagaacaacaaacgatttatcaggaagtctctgcgcttcttattacgctgtttgaa atcgccccggaggatattacccctgaggcacgtctttacgaggatctggatctcgacagc attgatgccgtcgatatggtggtgcacctgcaaaagaaaacgggccataaaatcaagccc gaaaccttcaaagcggtgcgcacggtgcaggacgtcgtggacgttgtggaacagcttcag cgcgacgcgtaa

DBGET integrated database retrieval system