Sinorhizobium numidicum: PYH37_003381 Help Entry PYH37_003381      CDS       T09000                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism enu  Sinorhizobium numidicum Pathway enu00998   Biosynthesis of various antibiotics enu01100   Metabolic pathways enu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PYH37_003381    00074 Mycolic acid biosynthesis     PYH37_003381   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PYH37_003381 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  WEX78486 LinkDB All DBs Position 1:1214247..1214483 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcatcttggcgttgacgcc gaaaaggtcagcgaaggcgctagcttcatcgatgatctcggcgcggactcgctcgacacg gtcgaactggtcatggcattcgaagaagaattcggtgtcgagattccggacgacgcagcg gattcgattctgaccgttggcgacgccgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system