Enterobacter sp. E20: NI40_008275 Help Entry NI40_008275       CDS       T04118                                  Name (GenBank) hypothetical protein   KO K12149   DNA-damage-inducible protein I Organism enx  Enterobacter sp. E20 Brite KEGG Orthology (KO) [BR:enx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:enx03400]     NI40_008275 DNA repair and recombination proteins [BR:enx03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     NI40_008275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF2397 KH_9 Motif Other DBs NCBI-ProteinID:  ALL17149 LinkDB All DBs Position complement(1761206..1761451) Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTVLPAGALDALAGELSRRINNTFPDNAGAVTVRYAAANNLSVIGAAKEDK DRISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtcaccatagccaaaacaaccgttctgcctgccggcgcgcttgatgca ctggcaggcgaattatcccgccgtattaacaacacctttcccgacaacgcgggtgccgta acggtgcgttacgccgcggcgaacaacctctccgtcatcggtgctgcgaaagaagataaa gatcgcatcagcgaaatcctgcaggaaacgtgggaaagcgcagacgactggtttatcaca gattaa

DBGET integrated database retrieval system