Enterobacter sp. E20: NI40_008440 Help Entry NI40_008440       CDS       T04118                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism enx  Enterobacter sp. E20 Pathway enx01100   Metabolic pathways enx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NI40_008440    00074 Mycolic acid biosynthesis     NI40_008440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NI40_008440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  ALL17182 LinkDB All DBs Position 1792886..1793122 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system