Enterobacter sp. E20: NI40_009780
Help
Entry
NI40_009780 CDS
T04118
Name
(GenBank) oxidoreductase
Organism
enx
Enterobacter sp. E20
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GFO_IDH_MocA_C
GFO_IDH_MocA
GFO_IDH_MocA_C3
NAD_binding_3
Semialdhyde_dh
AAA_33
Motif
Other DBs
NCBI-ProteinID:
ALL17431
LinkDB
All DBs
Position
2055213..2056253
Genome browser
AA seq
346 aa
AA seq
DB search
MSDNIRVGLIGYGYASKTFHAPLIAGTPGMTLAAVSSSDAAKVHADWPSVPVVSEPKHLF
NDPNIDLIVIPTPNDTHFPLAKAALDAGKHVVVDKPFTVTLSQARELDALAKSLGRLLSV
FHNRRWDSDFLTVKRLLSEGTLGEILFFESHFDRFRPQVRNRWREQAGPGSGIWYDLAPH
LLDQAVNLFGLPVSMTVDLAQLRPGAQTTDYFHAVLSYPQRRIVLHGTMVAAAESARYII
HGTRGSYVKFGLDPQEDRLKSGERLPQEDWGYDMRDGVVTRVEGEELVEETLLTIPGNYP
AYYAGIRDALNGTGENPVPASQAIQIMELIELGIESAKHRATLCLA
NT seq
1041 nt
NT seq
+upstream
nt +downstream
nt
atgagtgataatatccgcgttgggcttatcggctacgggtatgcaagcaaaacgtttcat
gcgcctctgatagccgggacgccggggatgaccctggctgcggtatccagcagcgatgcc
gctaaagtccatgccgactggccttccgtgccggttgtctctgagccaaaacaccttttc
aacgatccgaatattgatttaatcgttatccccaccccgaacgacacccacttcccgctg
gcaaaggccgcgcttgacgccggtaagcacgtggtggtcgataagccctttaccgtcacg
ttgtctcaggctcgcgagctggatgcgctggcaaagagtctgggcaggctgctgtcggta
ttccataaccgccgctgggacagcgactttctgacggtaaaaaggcttctcagtgaaggc
acgctaggggagatcctcttttttgaatcgcactttgaccgcttccgtccgcaggtacga
aaccgctggcgcgagcaggccggtccgggcagcggcatctggtacgatttagccccgcat
ctgctggatcaggccgtcaatctttttggtctgccggtgagcatgacggtcgatctggcc
cagctccggcccggagcgcagacgaccgattacttccacgcggtgctcagctacccgcag
cggcgaattgtgctgcacggcacgatggtcgcggccgcggaatcggcccgctacatcatt
cacggcacgcgcgggagctacgtgaagtttggcctcgatccgcaggaggaccggctgaaa
agcggtgaacgtttgccgcaggaagactggggctatgatatgcgcgacggcgtggtcacg
cgggtggaaggtgaggaactggtagaggagaccttgctgacgatcccgggcaactatccg
gcctattatgcgggcattcgcgatgcgctgaacggcacgggcgaaaatccggttccggcc
agccaggcgattcagattatggaactgattgagctgggtattgaatctgccaaacatcgc
gccacgctctgtctggcataa
DBGET
integrated database retrieval system