KEGG   Escherichia coli O7 K1 CE10: CE10_2351
Entry
CE10_2351         CDS       T01999                                 

Gene name
wbbB
Definition
(GenBank) component WbbB of exported sugar polymer
  KO
K23198  O7-antigen biosynthesis rhamnosyltransferase
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00542  O-Antigen repeat unit biosynthesis
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00542 O-Antigen repeat unit biosynthesis
    CE10_2351 (wbbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eoc01005]
    CE10_2351 (wbbB)
Lipopolysaccharide biosynthesis proteins [BR:eoc01005]
 O-antigen repeat unit
  CE10_2351 (wbbB)
SSDB
Motif
Pfam: DUF5889
Other DBs
NCBI-ProteinID: AEQ13125
UniProt: A0A0E0V7R0
LinkDB
Position
complement(2369325..2370146)
AA seq 273 aa
MDCKKKLCIVACSYTLKPEFIINKLYNYLPDYELDGVVISNNHIVEQITMKGFHIENGTN
SLFEFSAYKEGIDFLEDSSLLPSGVPILILNDTLFLKHNAKFFLRKIVSYYSTIQRTELP
TMAGRLDPYNNICYSNSWNNMNGYISSFCMLINEKSAKIIVSCYNELPKYFFSNDIDIID
PKWGMQIESRLREFIRSHLIDIDTDTVWYQAKLLHNDKQRINIKAQCVFMEHFISGKIGE
SGIVVSIFPTWKGKVLNFLNEQLAKIKRKIIIK
NT seq 822 nt   +upstreamnt  +downstreamnt
atggattgtaaaaaaaaattatgcattgtggcctgttcttatactttaaagccagaattc
ataattaataaattatataattatttaccagattatgaactagatggtgttgtgatttcc
aataatcatatagtagaacagattacaatgaagggatttcatatcgaaaacgggacaaat
tctctttttgagttttctgcctataaggaaggaatagattttttagaagatagctcatta
ttaccatcaggagtaccaattctcattttgaatgatacattgttcttgaaacataatgca
aaattctttttaaggaaaattgtgagttattattcaacaattcaaagaactgaattgcct
acaatggcaggtcgtttagatccttataataatatatgttacagtaactcttggaataat
atgaatggctatatatcttccttttgtatgctaataaatgaaaaatctgcaaaaataatt
gttagttgctacaatgagcttccaaaatatttttttagtaatgatattgatattattgac
cccaaatggggaatgcagattgaatcaagactgagagaatttattcgtagtcatttaatt
gatatagacacagatacggtttggtatcaagctaaattgttacataatgataaacaacga
attaatattaaagctcaatgtgtcttcatggaacatttcatatcagggaagattggtgaa
agtggaattgttgtttctatttttcccacatggaaaggaaaggtgttaaattttttaaac
gagcaattggctaaaatcaagaggaagattataattaaatga

DBGET integrated database retrieval system