Endosymbiont of Sipalinus gigas: NARSGI1_01890 Help Entry NARSGI1_01890     CDS       T06000                                  Symbol rpmG Name (GenBank) 50S ribosomal protein L33   KO K02913   large subunit ribosomal protein L33 Organism eof  Endosymbiont of Sipalinus gigas Pathway eof03010   Ribosome Brite KEGG Orthology (KO) [BR:eof00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NARSGI1_01890 (rpmG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eof03011]     NARSGI1_01890 (rpmG) Ribosome [BR:eof03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     NARSGI1_01890 (rpmG)   Bacteria     NARSGI1_01890 (rpmG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L33 Motif Other DBs NCBI-ProteinID:  BBA85326 UniProt:  A0A2Z5TA36 LinkDB All DBs Position complement(166490..166660) Genome browser AA seq 56 aa AA seqDB search MKSSREKIKLLSSISNHFYTTTKSKKLKLKKIEMKKFDPFIKKHVLYKECKINKKK NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgaaaagttcaagagaaaaaataaaattactttcaagtatatctaatcatttttataca acaacaaaaagtaaaaaattaaaattaaaaaaaatagaaatgaaaaagtttgatccattt attaaaaaacatgttttatataaagaatgtaagataaataaaaaaaaataa

DBGET integrated database retrieval system