Endosymbiont of Sipalinus gigas: NARSGI1_02410 Help Entry NARSGI1_02410     CDS       T06000                                  Symbol rpmA Name (GenBank) 50S ribosomal protein L27   KO K02899   large subunit ribosomal protein L27 Organism eof  Endosymbiont of Sipalinus gigas Pathway eof03010   Ribosome Brite KEGG Orthology (KO) [BR:eof00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NARSGI1_02410 (rpmA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eof03011]     NARSGI1_02410 (rpmA) Ribosome [BR:eof03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     NARSGI1_02410 (rpmA)   Bacteria     NARSGI1_02410 (rpmA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L27 Motif Other DBs NCBI-ProteinID:  BBA85369 UniProt:  A0A2Z5TQ98 LinkDB All DBs Position 210228..210485 Genome browser AA seq 85 aa AA seqDB search MAHKKAAGSTRNGRDSPGKRLGLKHFGGEIVYPGNILIRQRGSKFHPGVNVGCGKDYTLF SLIRGIIKFKKNKINNKKVIYVIPI NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctcataaaaaagctgctggatctacaagaaatggaagagattctcctggtaaaaga ttaggattaaaacattttggaggagaaattgtatatcctggtaatatattaattagacaa agaggaagtaaatttcatcctggtgttaatgttggatgtggaaaggattatactttattt tcattaataagaggaataataaaatttaaaaaaaataaaataaataataaaaaagttata tatgtaataccaatttaa

DBGET integrated database retrieval system