Endosymbiont of Sipalinus gigas: NARSGI1_02650 Help Entry NARSGI1_02650     CDS       T06000                                  Symbol rpmH Name (GenBank) 50S ribosomal protein L34   KO K02914   large subunit ribosomal protein L34 Organism eof  Endosymbiont of Sipalinus gigas Pathway eof03010   Ribosome Brite KEGG Orthology (KO) [BR:eof00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NARSGI1_02650 (rpmH)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eof03011]     NARSGI1_02650 (rpmH) Ribosome [BR:eof03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     NARSGI1_02650 (rpmH)   Bacteria     NARSGI1_02650 (rpmH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L34 Motif Other DBs NCBI-ProteinID:  BBA85385 UniProt:  A0A2Z5T976 LinkDB All DBs Position complement(230379..230516) Genome browser AA seq 45 aa AA seqDB search MKRTFQPSNIRRKRKIGFRIRMSTKSGRKILNNRRNKKRNNLIVA NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgaaaagaacatttcaaccgtcaaatataagacgtaaaagaaaaattggatttagaata agaatgtcaactaaatctggaagaaaaatattaaataatagaagaaataaaaaaagaaat aatttaattgtagcttaa

DBGET integrated database retrieval system