Escherichia coli O103 H2 12009 (EHEC): ECO103_0729 Help Entry ECO103_0729       CDS       T01096                                  Symbol ybgT Name (GenBank) conserved predicted protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism eoh  Escherichia coli O103:H2 12009 (EHEC) Pathway eoh00190   Oxidative phosphorylation eoh01100   Metabolic pathways eoh02020   Two-component system Module eoh_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eoh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ECO103_0729 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ECO103_0729 (ybgT) Enzymes [BR:eoh01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ECO103_0729 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  BAI29584 LinkDB All DBs Position 807301..807414 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system