KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_2223
Entry
ECO103_2223       CDS       T01096                                 

Definition
(GenBank) T3SS secreted effector NleF-like protein
  KO
K23658  T3SS secreted effector NleF
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO103_2223
SSDB
Motif
Pfam: NleF_casp_inhib DUF4468
Other DBs
NCBI-ProteinID: BAI31015
LinkDB
Position
complement(2283394..2283963)
AA seq 189 aa
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLTPELQDKLDAMISIYSNARNSN
ELEEIYQELSAFVSGLMDKRNSVFEVRNENTDEVVGALREGMTIDDRDGYIRELFFLYSL
KVKIEESRQGKEDSKCKVYGLLCPHHSSELYGDLRAMKCLVEGCSDDFDPFDIIRVPDLT
YNKGALQCG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgttaccaacaagtggctcttcagcaaatctttattcatggatgtatgtatcaggaaga
ggtaacccttcgactccggaatcagtaagtgaacttaatcataatcattttcttactcct
gaattacaagataaacttgatgctatgatctctatatactcaaatgccagaaatagtaat
gagcttgaggaaatttatcaagagctaagtgcttttgtaagtgggctgatggataagaga
aatagtgtatttgaggtgagaaatgaaaatactgatgaggttgtcggagcactgagggag
gggatgacgatagatgacagggatggttatatcagggagcttttttttctgtattcattg
aaagtaaaaattgaggaaagtagacaaggtaaagaagattctaaatgtaaagtttatggt
ctgttatgtccgcatcactcttcagagctatatggtgatctacgagcaatgaaatgtctt
gtggaaggatgcagtgatgattttgatccttttgatattattagggtgccggatcttact
tacaacaaaggagctttacaatgtggatga

DBGET integrated database retrieval system