Escherichia coli O111 H- 11128 (EHEC): ECO111_0751 Help Entry ECO111_0751       CDS       T01097                                  Symbol ybgT Name (GenBank) conserved predicted protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism eoi  Escherichia coli O111:H- 11128 (EHEC) Pathway eoi00190   Oxidative phosphorylation eoi01100   Metabolic pathways eoi02020   Two-component system Module eoi_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eoi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ECO111_0751 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ECO111_0751 (ybgT) Enzymes [BR:eoi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ECO111_0751 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  BAI34716 LinkDB All DBs Position 817464..817577 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system