KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_1991
Entry
ECO111_1991       CDS       T01097                                 
Name
(GenBank) T3SS secreted effector EspM-like protein
  KO
K23653  T3SS effector EspM
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO111_1991
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: BAI35875
LinkDB
Position
complement(2005812..2006402)
AA seq 196 aa
MPVNATGVSFSSFGISYHKDNSFRGTIRGKNDEVVKCSMGERSIRFNVNKFSGCILETVS
RQSTKDIHGWVSDERTVYPSRVINQEIDNCCLQKNAKISSEERKMVFSLVSKEFELTLDV
KAAQSSINHIIIGNASFGKKMDALCDGMSRAVKNTTTDYIANVLADKFYQKHIAPGVDIV
KLRNEIPGYMSRVIQG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccagtaaatgcgacaggtgtgtccttcagctcttttggtatcagttatcataaagat
aattctttccggggcaccatccgtgggaagaatgatgaggtcgtgaagtgttcaatggga
gagcgctctatccgctttaatgttaacaaatttagcggctgtatactggagacggtaagc
aggcagagtactaaagatattcatggatgggtaagtgatgaacggacagtatatccgtca
agggttatcaaccaagagattgataattgctgccttcaaaaaaatgcaaaaatttcttct
gaagagaggaaaatggtcttttctcttgtaagtaaggagtttgaactaactcttgatgtt
aaagcggcacaaagttctattaatcatataataataggaaatgcttcttttggcaaaaaa
atggatgctctttgcgatggtatgagccgagctgtaaaaaacactacaacagattacata
gcaaacgtgcttgcagacaagttttatcagaaacatatcgccccgggtgttgatattgta
aaactacgaaatgaaatcccaggttatatgagtcgtgttatacaggggtaa

DBGET integrated database retrieval system