KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_1817
Entry
ECO26_1817        CDS       T01098                                 
Name
(GenBank) T3SS secreted effector EspM-like protein
  KO
K23653  T3SS effector EspM
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO26_1817
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: BAI25104
LinkDB
Position
1770794..1771384
AA seq 196 aa
MPVNATGVSFSSFGISYHKDNSFRGTIRGKNDEVVKCSMGERSIRFNVNKFSGCILETVS
RQSTKDIHGWVSDERTVYPSRVINQEIDNCCLQKNAKISSEERKMVFSLVSKEFELTLDV
KAAQSSINHIIIGNASFGKKMDALCDGMSRAVKNSTTDYIANVLADKFYQKHIAPGVDIV
KLRNEIPGYMSRVIQG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccagtaaatgcgacaggtgtgtccttcagctcttttggtatcagttatcataaagat
aattctttccggggcaccatccgtgggaagaatgatgaggtcgtgaagtgttcaatggga
gagcgctctatccgctttaatgttaacaaatttagcggctgtatactggagacggtaagc
aggcagagtactaaagatattcatggatgggtaagtgatgaacggacagtatatccgtca
agggttatcaaccaagagattgataattgctgccttcaaaaaaatgcaaaaatttcttct
gaagagaggaaaatggtcttttctcttgtaagtaaggagtttgaactaactcttgatgtt
aaagcggcacaaagttctattaatcatataataataggaaatgcttcttttggcaaaaaa
atggatgctctttgcgatggtatgagccgagctgtaaaaaacagtacaacagattacata
gcaaacgtgcttgcagacaagttttatcagaaacatatcgccccgggtgttgatattgta
aaactacgaaatgaaatcccaggttatatgagtcgtgttatacaggggtaa

DBGET integrated database retrieval system