KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2428
Entry
G2583_2428        CDS       T01190                                 
Name
(GenBank) unknown protein encoded within prophage CP-933U
  KO
K23648  T3SS secreted effector ADP-ribosyltransferase EspJ
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_2428
SSDB
Motif
Pfam: AvrPphF-ORF-2
Other DBs
NCBI-ProteinID: ADD56987
UniProt: D3QWZ7
LinkDB
Position
2438361..2439014
AA seq 217 aa
MSIIKNCLSLINNALNIQKTSYSLTKMEQAGKLLNRKITPENTPPMLLSYRNADLTQEKN
ITERVLSIFKIKRDFVAVRIQNNQFTDLKNKKIQGHQNTVASVMDWYNPQKNALGITMGT
PRKSADIAKEEHRNALNFMIMEKNTFHEKILNSNDNLQKSYSKTEDSSWVAASVGSLLDK
GAKVYPDTSCSLRLGEPFIFTLPESVRVDVDIYPLKK
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtcaattataaaaaactgcttatcattaattaacaatgcattaaatatacaaaaaaca
tcatattctctgaccaaaatggagcaggcagggaagttgttaaatagaaaaataactcca
gaaaatactcctccaatgttgttatcatacagaaatgcagatttaacgcaagaaaaaaac
attacagaaagagttttatccatatttaaaataaaacgagattttgttgctgtaagaatc
caaaacaatcagtttactgatttgaaaaacaaaaaaattcaaggccatcaaaacacagtt
gccagtgtcatggattggtataatccccaaaaaaatgctttgggtataactatgggtaca
ccaagaaaatcggccgatatagcaaaagaagagcacagaaatgcactaaatttcatgata
atggaaaaaaacacatttcatgaaaaaatcttaaacagcaatgacaatttgcaaaaatca
tacagcaaaacagaagacagtagttgggtcgcagcttctgtcggctctcttctagataaa
ggagcaaaagtatatcccgatacatcatgctctctgagactgggagaaccattcatcttt
acgctgccagaatcagttagagtcgatgttgacatatatcctctcaaaaaataa

DBGET integrated database retrieval system