KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2429
Entry
G2583_2429        CDS       T01190                                 
Name
(GenBank) Tir-cytoskeleton coupling protein
  KO
K12789  Tir-cytoskeleton coupling protein
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok02024  Quorum sensing
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G2583_2429
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_2429
SSDB
Motif
Pfam: EspF
Other DBs
NCBI-ProteinID: ADD56988
UniProt: D3QWZ8
LinkDB
Position
2439339..2440211
AA seq 290 aa
MINNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPN
AHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQ
NEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQR
LVQHLAEHGIQPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPA
RNMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGINTSKRS
NT seq 873 nt   +upstreamnt  +downstreamnt
atgattaacaatgtttcttcactttttccaaccgtcaaccgcaatattacagctgtatat
aaaaaaagcagcttctctgtatcaccacagaaaatcacattaaatcctgtaaaaatcagc
tcacctttttcaccaagcagtagctccatcagcgcaacaactctctttcgagccccaaac
gcccattcggcatcatttcatcgacagtctactgctgaaagttcgttacatcaacaactt
cctaatgtgaggcagcgcctgatacaacatcttgcagagcatggcattaaacctgcccgg
agtatggctgaacatattcctccggcacctaactggcctgcgccaccaccgccagtacaa
aatgaacaatcaagacctctgcctgatgtggctcagcgtctggtgcagcatcttgcagag
catggcattcaaccagcccggaatatggctgaacatattcctccggcacctaactggcct
gcgccaccactgccagtacaaaatgaacaatcaagacctctgcctgatgtggctcagcgt
ctggtgcagcatcttgcagagcatggcattcaaccagcccggagtatggctgaacatatt
cctccggcacctaactggcctgcgccaccaccgccagtacaaaatgaacaatcaagacct
ctgcctgatgtggctcagcgtctggtgcagcatcttgcagagcatggcattcaaccagcc
cggaatatggctgaacatattcctccggcacctaactggcctgcgccaccaccgccagta
caaaatgaacaatcaagacctctgcctgatgtggctcagcgtctggtgcagcatcttgca
gagcatggcattaatacatctaagcgctcgtga

DBGET integrated database retrieval system