Escherichia coli O55 H7 CB9615 (EPEC): G2583_4182 Help Entry G2583_4182        CDS       T01190                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism eok  Escherichia coli O55:H7 CB9615 (EPEC) Pathway eok01100   Metabolic pathways eok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eok00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G2583_4182    00074 Mycolic acid biosynthesis     G2583_4182   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G2583_4182 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADD58653 LinkDB All DBs Position 4224207..4224464 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLDELTPDDIDTDAPLFGDGLGLDSIDALELGLAVKNEYGIVLS AESEEMRQHFFSVATLASFIAAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatctggaaattaaaaacctcatcatcagcaccctcaatctggacgag ttgacgcctgatgatatcgataccgacgcgccgctgtttggcgacggtttagggctggac tctatcgatgccctggaactgggactggcagtaaaaaatgagtacggcatcgtgctctct gcggaaagcgaagagatgcgtcagcactttttctccgtcgccactctggcctctttcatt gctgcgcaacgtgcctga

DBGET integrated database retrieval system