KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4405
Entry
G2583_4405        CDS       T01190                                 
Symbol
espF
Name
(GenBank) espF
  KO
K12786  LEE-encoded effector EspF
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_4405 (espF)
SSDB
Motif
Pfam: EspF
Other DBs
NCBI-ProteinID: ADD58872
UniProt: D3QW11
LinkDB
Position
complement(4476749..4477513)
AA seq 254 aa
MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNART
IFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKP
ARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQA
SGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQA
LKDHLAAYEQSKKG
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcttaatggaattagtaacgctgcttctacactagggcggcagcttgtaggtatcgca
agtcgagtgagctctgcggggggaactggattttctgtagcccctcaggccgtgcgtctt
actccggtgaaagttcattcccctttttctccaggctcgtcgaatgttaatgcgagaacg
atttttaatgtgagcagccaggtgacttcatttactccctctcgtccggcaccgccgcca
ccgacaagtggacaggcatccggggcatcccgacctttaccgcccattgcacaggcatta
aaagagcacttggctgcctatgaaaaatcgaaaggtcctgaggctttaggttttaagccc
gcccgtcaggcaccgccgccaccgacaagtggacaggcatccggggcatcccgaccttta
ccgcccattgcacaggcattaaaagagcacttggctgcctatgaaaaatcgaaaggtcct
gaggctttaggttttaagcccgcccgtcaggcaccgccgccaccgacaagtggacaggca
tccggggcatcccgacctttaccgcccattgcacaggcattaaaagagcacttggctgcc
tatgaaaaatcgaaaggtcctgaggctttaggttttaagcccgcccgtcaggcaccgccg
ccaccgacaagtggacaggcatccggggcatcccgacctttaccgcccattgcacaggca
ttaaaagatcatttagctgcctatgagcaatcgaagaaagggtaa

DBGET integrated database retrieval system