KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4407
Entry
G2583_4407        CDS       T01190                                 
Symbol
escF
Name
(GenBank) Type III secretion apparatus needle protein
  KO
K03221  type III secretion protein F
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok03070  Bacterial secretion system
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    G2583_4407 (escF)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_4407 (escF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eok02044]
    G2583_4407 (escF)
Secretion system [BR:eok02044]
 Type III secretion system
  Type III secretion core apparatus
   G2583_4407 (escF)
SSDB
Motif
Pfam: T3SS_needle_F Spectrin
Other DBs
NCBI-ProteinID: ADD58874
UniProt: D3QW13
LinkDB
Position
complement(4477882..4478103)
AA seq 73 aa
MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQQYSAYVNVESGMLKT
IKDLVSTISNRSF
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaatttatctgaaattactcaacaaatgggtgaagtaggtaaaacgctgagcgattct
gtgccagagttacttaatagcaccgatttggttaatgaccctgaaaaaatgttagagttg
cagtttgcggttcagcaatattctgcttatgttaacgtagaaagtggaatgttgaaaacg
ataaaagatctggtctcaaccatttctaaccgtagtttttaa

DBGET integrated database retrieval system