KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4414
Entry
G2583_4414        CDS       T01190                                 
Symbol
eae
Name
(GenBank) Gamma intimin
  KO
K12790  intimin
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_4414 (eae)
SSDB
Motif
Pfam: IAT_beta Intimin_C Big_1 LysM Big_2 DUF4198 Glyco_hydro2_C5 MG4 DUF6795 PilX YtkA
Other DBs
NCBI-ProteinID: ADD58881
UniProt: D3QW20
LinkDB
Position
complement(4483968..4486772)
AA seq 934 aa
MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYFKLGSDSKLLTHDSYQ
NRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKAAPGQQIILPLKKLPFE
YSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKALNYAAQQAASLGSQLQSR
SLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKM
LAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYF
KSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVAL
FNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIE
PQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNIPHDINGTEHSTQKIQLIVKSKY
GLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAYVQGGSNIYKVTARAYDRNGNSSN
NVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNADTITYTATVKKNGVAQANVPVSFNI
VSGTATLGANSAKTDANGKATVTLKSSTPGQVVVSAKTAEMTSALNASAVIFFDQTKASI
TEIKADKTTAVANGKDAIKYTVKVMKNGQPVNNQSVTFSTNFGMFNGKSQTQATTGNDGR
ATITLTSSSAGKATVSATVSDGAEVKATEVTFFDELKIDNKVDIIGNNVRGELPNIWLQY
GQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPS
YMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSS
EQSSGVSSTYNLITQNPLPRVNVNTPNVYAVCVE
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgattactcatggttgttatacccggacccggcacaagcataagctaaaaaaaacattg
attatgcttagtgctggtttaggattgtttttttatgttaatcagaattcatttgcaaat
ggtgaaaattattttaaattgggttcggattcaaaactgttaactcatgatagctatcag
aatcgccttttttatacgttgaaaactggtgaaactgttgccgatctttctaaatcgcaa
gatattaatttatcgacgatttggtcgttgaataagcatttatacagttctgaaagcgaa
atgatgaaggccgcgcctggtcagcagatcattttgccactcaaaaaacttccctttgaa
tacagtgcactaccacttttaggttcggcacctcttgttgctgcaggtggtgttgctggt
cacacgaataaactgactaaaatgtccccggacgtgaccaaaagcaacatgaccgatgac
aaggcattaaattatgcggcacaacaggcggcgagtctcggtagccagcttcagtcgcga
tctctgaacggcgattacgcgaaagataccgctcttggtatcgctggtaaccaggcttcg
tcacagttgcaggcctggttacaacattatggaacggcagaggttaatctgcagagtggt
aataactttgacggtagttcactggacttcttattaccgttctatgattccgaaaaaatg
ctggcatttggtcaggtcggagcgcgttacattgactcccgctttacggcaaatttaggt
gcgggtcagcgttttttccttcctgcaaacatgttgggctataacgtcttcattgatcag
gatttttctggtgataatacccgtttaggtattggtggcgaatactggcgagactatttc
aaaagtagcgttaacggctatttccgcatgagcggctggcatgagtcatacaataagaaa
gactatgatgagcgcccagcaaatggcttcgatatccgttttaatggctatctaccgtca
tatccggcattaggcgccaagctgatatatgagcagtattatggtgataatgttgctttg
tttaattctgataagctgcagtcgaatcctggtgcggcgaccgttggtgtaaactatact
ccgattcctctggtgacgatggggatcgattaccgtcatggtacgggtaatgaaaatgat
ctcctttactcaatgcagttccgttatcagtttgataaatcgtggtctcagcaaattgaa
ccacagtatgttaacgagttaagaacattatcaggcagccgttacgatctggttcagcgt
aataacaatattattctggagtacaagaagcaggatattctttctctgaatattccgcat
gatattaatggtactgaacacagtacgcagaagattcagttgatcgttaagagcaaatac
ggtctggatcgtatcgtctgggatgatagtgcattacgcagtcagggcggtcagattcag
catagcggaagccaaagcgcacaagactaccaggctattttgcctgcttatgtgcaaggt
ggcagcaatatttataaagtgacggctcgcgcctatgaccgtaatggcaatagctctaac
aatgtacagcttactattaccgttctgtcgaatggtcaagttgtcgaccaggttggggta
acggactttacggcggataagacttcggctaaagcggataacgccgataccattacttat
accgcgacggtgaaaaagaatggggtagctcaggctaatgtccctgtttcatttaatatt
gtttcaggaactgcaactcttggggcaaatagtgccaaaacggatgctaacggtaaggca
accgtaacgttgaagtcgagtacgccaggacaggtcgtcgtgtctgctaaaaccgcggag
atgacttcagcacttaatgccagtgcggttatattttttgatcaaaccaaggccagcatt
actgagattaaggctgataagacaactgcagtagcaaatggtaaggatgctattaaatat
actgtaaaagttatgaaaaacggtcagccagttaataatcaatccgttacattctcaaca
aactttgggatgttcaacggtaagtctcaaacgcaagcaaccacgggaaatgatggtcgt
gcgacgataacactaacttccagttccgccggtaaagcgactgttagtgcgacagtcagt
gatggggctgaggttaaagcgactgaggtcactttttttgatgaactgaaaattgacaac
aaggttgatattattggtaacaatgtcagaggcgagttgcctaatatttggctgcaatat
ggtcagtttaaactgaaagcaagcggtggtgatggtacatattcatggtattcagaaaat
accagtatcgcgactgtcgatgcatcagggaaagtcactttgaatggtaaaggcagtgtc
gtaattaaagccacatctggtgataagcaaacagtaagttacactataaaagcaccgtcg
tatatgataaaagtggataagcaagcctattatgctgatgctatgtccatttgcaaaaat
ttattaccatccacacagacggtattgtcagatatttatgactcatggggggctgcaaat
aaatatagccattatagttctatgaactcaataactgcttggattaaacagacatctagt
gagcagagttctggagtatcaagcacttataacctaataacacaaaaccctcttcctagg
gttaatgttaatactccaaatgtctatgcggtttgtgtagaataa

DBGET integrated database retrieval system