Exaiptasia diaphana (Aiptasia): 110252351 Help Entry 110252351         CDS       T05080                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism epa  Exaiptasia diaphana (Aiptasia) Pathway epa04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:epa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110252351  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:epa04121]     110252351    03400 DNA repair and recombination proteins [BR:epa03400]     110252351 Ubiquitin system [BR:epa04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110252351    Cul5 complex      110252351 DNA repair and recombination proteins [BR:epa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110252351 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  110252351 NCBI-ProteinID:  XP_020914819 UniProt:  A0A913Y4V1 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MVCEVFLMVRRTKTSMFLDCKEGTTVVDVKKMIEGIIKRPPEDQRLFKDEQILDDNKTLG DCGFTNQTSKAQTPAVLGLALRQDDGEFEQLAIDPLSSPPELPDVMKPQESASNSEGS NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggtttgtgaagtatttctgatggtacgtcgcacaaagacgagcatgtttctcgattgc aaggaggggacgactgtcgtagatgtaaagaaaatgatagaaggaataattaaacgacct cctgaagaccagagactttttaaagacgagcaaatactcgacgacaacaagactcttggt gattgtggttttacaaatcagacttcaaaggcgcaaacaccggctgtccttggccttgca cttcgacaggatgatggagaattcgagcaactggcaattgatcctctatccagccctcct gagctgcctgatgtaatgaaaccccaagagagtgcctcaaacagcgaaggctcttag

DBGET integrated database retrieval system