Erwinia persicina: CI789_09595 Help Entry CI789_09595       CDS       T05618                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism epe  Erwinia persicina Pathway epe00998   Biosynthesis of various antibiotics epe01100   Metabolic pathways epe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:epe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CI789_09595    00074 Mycolic acid biosynthesis     CI789_09595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CI789_09595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXU95460 UniProt:  A0A3S7S435 LinkDB All DBs Position 2083577..2083837 Genome browser AA seq 86 aa AA seqDB search MLNQNAVMDYILACLRGMVASDVDIEPDSDLVDELGLESIRVMDLLMMLEDRFDIPIPIN ILLDVRTPVQLRDALLPFLEKTYGPL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctgaatcaaaacgcggtaatggactatatcctggcatgtttacgcggcatggtggcc agtgacgttgacatagaaccagacagcgatcttgttgacgagctgggtctggaatcgatc agggtaatggatctgctgatgatgttagaggacaggtttgatatccctatccctatcaat atattgctggatgtcaggactccggtacagctgcgggatgcgttactccccttcctggag aaaacctatgggcctttatga

DBGET integrated database retrieval system