KEGG   Exiguobacterium profundum: OE059_08995
Entry
OE059_08995       CDS       T08917                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
epf  Exiguobacterium profundum
Pathway
epf02020  Two-component system
epf02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:epf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OE059_08995
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    OE059_08995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:epf02022]
    OE059_08995
   02035 Bacterial motility proteins [BR:epf02035]
    OE059_08995
Two-component system [BR:epf02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   OE059_08995
Bacterial motility proteins [BR:epf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    OE059_08995
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: WED54191
UniProt: A0ABY8AWC2
LinkDB
Position
complement(1710500..1710865)
AA seq 121 aa
MSAKVLVVDDAAFMRMMIKDILTKNGYDVVGEAENGADAVAKYRELTPDLVTLDITMPEM
DGLAALKEIRSFDSNAKIIMCSAMGQQAMVIDAIQAGAKDFIVKPFNAERVIEAVSKTVA
Q
NT seq 366 nt   +upstreamnt  +downstreamnt
atgagtgcaaaagtattagtagtggatgacgcagcgttcatgcgtatgatgatcaaggac
attttgacaaagaatggatatgacgtagtaggtgaggcagaaaacggcgcggacgctgtc
gcgaaataccgtgaactcacaccggatctcgtcacacttgatatcacgatgcctgagatg
gatggactcgcagcattgaaagaaattcgtagcttcgactcgaatgcgaaaatcatcatg
tgttcagcgatgggacaacaagcgatggtcatcgatgccattcaagctggagcaaaagac
ttcatcgtcaagcctttcaatgcagaacgtgtcatcgaagcagtttctaaaacggtcgca
caatga

DBGET integrated database retrieval system