Erwinia pyri: Q3V30_08240 Help Entry Q3V30_08240       CDS       T10311                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism epi  Erwinia pyri Pathway epi01100   Metabolic pathways epi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:epi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q3V30_08240 (acpP)    00074 Mycolic acid biosynthesis     Q3V30_08240 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q3V30_08240 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  WLS80454 UniProt:  A0AA50DM53 LinkDB All DBs Position 1776530..1776766 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgagcagcttggcgttaagcag gaagaagttgttaatactgcctcttttgtagaagatctgggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgataccgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgctattgattacatcaatggtcaccaggcgtaa

DBGET integrated database retrieval system