Candidatus Endoriftia persephonae: L0Y14_11955 Help Entry L0Y14_11955       CDS       T08211                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism eps  Candidatus Endoriftia persephonae Pathway eps00020   Citrate cycle (TCA cycle) eps00720   Other carbon fixation pathways eps01100   Metabolic pathways eps01110   Biosynthesis of secondary metabolites eps01120   Microbial metabolism in diverse environments eps01200   Carbon metabolism eps01210   2-Oxocarboxylic acid metabolism Module eps_M00009   Citrate cycle (TCA cycle, Krebs cycle) eps_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:eps00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L0Y14_11955   09102 Energy metabolism    00720 Other carbon fixation pathways     L0Y14_11955 Enzymes [BR:eps01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L0Y14_11955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_21 Fer4_2 Fer4_4 Fer4_10 Fer4_16 LdpA_Fe-S-bd Fer4_9 Fer4_17 Fer4_8 Fer4_3 Fer4_22 Fer4_15 Motif Other DBs NCBI-ProteinID:  USF86844 UniProt:  A0A9J6ZVP9 LinkDB All DBs Position 2650825..2651085 Genome browser AA seq 86 aa AA seqDB search MAFGKIKEITGVVTINKSWCKGCGFCVNYCPTDALAMSSEYNAKGYHPPFVKSPDDCRNC DFCQTICPEFAIYVTRKAEQEENENA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcattcggcaaaatcaaagagatcaccggcgttgtcaccatcaacaagtcttggtgc aagggatgcggcttctgcgtcaattattgcccgaccgatgccctcgccatgtcatctgaa tataacgccaagggatatcatcccccgttcgtcaaatcgccggatgattgcaggaattgt gatttctgccagacgatctgtccggaattcgccatttacgtcacccgcaaggcggaacaa gaggagaatgagaatgcgtaa

DBGET integrated database retrieval system