Candidatus Endoriftia persephonae: L0Y14_12100 Help Entry L0Y14_12100       CDS       T08211                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism eps  Candidatus Endoriftia persephonae Brite KEGG Orthology (KO) [BR:eps00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:eps03110]     L0Y14_12100 (grxC) Chaperones and folding catalysts [BR:eps03110]  Protein folding catalysts   Protein disulfide isomerase    L0Y14_12100 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N CLIC-like_N T2SSM_b CoA_binding_3 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  USF86872 UniProt:  A0A9J6ZW47 LinkDB All DBs Position 2693742..2694005 Genome browser AA seq 87 aa AA seqDB search MPKVVMYTTAVCPYCVRAKYLLNNKGVEFDEIRIDMNQDAMQEMLQRSQRNTVPQIFIDE LHVGGYDDMAALEMAGRLDQLLGLAES NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcccaaggtagttatgtacacgacggcggtctgcccctactgcgtacgcgcaaaatat ctgctgaacaacaagggggtcgagttcgacgagatccgcattgacatgaaccaagatgcc atgcaagagatgttgcagcgcagccaacgcaacacagtgccgcagatcttcatcgacgaa ttgcatgtcggcggttatgacgatatggcggcgctggagatggcgggccgcctcgatcag ctgctggggctggcggaaagctga

DBGET integrated database retrieval system