Erwinia pyrifoliae Ep1/96: EpC_21470 Help Entry EpC_21470         CDS       T01000                                  Symbol acpP Name (GenBank) Probable acyl carrier protein   KO K02078   acyl carrier protein Organism epy  Erwinia pyrifoliae Ep1/96 Pathway epy00998   Biosynthesis of various antibiotics epy01100   Metabolic pathways epy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:epy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EpC_21470 (acpP)    00074 Mycolic acid biosynthesis     EpC_21470 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EpC_21470 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  CAX55926 LinkDB All DBs Position complement(2388665..2388901) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgagcagctgggcgttaagcag gaagaagttgttaatactgcctcttttgtggaagatttgggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagttcgataccgagatcccggacgaagaagct gagaaaatcactaccgttcaggctgctattgattatatcaatggtcaccaggcgtaa

DBGET integrated database retrieval system