Equus przewalskii (Przewalski's horse): 103540291 Help Entry 103540291         CDS       T04644                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04137   Mitophagy - animal epz04140   Autophagy - animal epz04144   Endocytosis epz04145   Phagosome epz04148   Efferocytosis epz05132   Salmonella infection epz05146   Amoebiasis epz05152   Tuberculosis Brite KEGG Orthology (KO) [BR:epz00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103540291 (RAB7A)    04145 Phagosome     103540291 (RAB7A)    04140 Autophagy - animal     103540291 (RAB7A)    04137 Mitophagy - animal     103540291 (RAB7A)    04148 Efferocytosis     103540291 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103540291 (RAB7A)    05152 Tuberculosis     103540291 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     103540291 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:epz04131]     103540291 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103540291 (RAB7A)    04031 GTP-binding proteins [BR:epz04031]     103540291 (RAB7A) Membrane trafficking [BR:epz04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103540291 (RAB7A) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103540291 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    103540291 (RAB7A)   Exosomal proteins of colorectal cancer cells    103540291 (RAB7A)   Exosomal proteins of bladder cancer cells    103540291 (RAB7A) GTP-binding proteins [BR:epz04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103540291 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  103540291 NCBI-ProteinID:  XP_070430681 LinkDB All DBs Position 15:2765313..2818752 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKAPGEGCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttactgaaggttatcatcttgggagattctggagtcggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagccaca ataggagcagactttcttacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacggcaggacaggaacggttccagtctcttggtgtggccttctacagaggt gcagactgctgtgttctggtatttgatgtgactgcccccaacacgttcaaaactcttgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttt gttgtattgggaaacaagattgacctcgagaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaaacaggaaacggaggtg gagctatacaatgaattccctgaacccatcaaactggacaagaatgaccgggccaaggcc ccgggagaaggctgcagctgctga

DBGET integrated database retrieval system