Equus przewalskii (Przewalski's horse): 103547610 Help Entry 103547610         CDS       T04644                                  Symbol H2AC21 Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz03082   ATP-dependent chromatin remodeling epz04217   Necroptosis epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103547610 (H2AC21)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103547610 (H2AC21)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103547610 (H2AC21)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     103547610 (H2AC21)   09165 Substance dependence    05034 Alcoholism     103547610 (H2AC21)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103547610 (H2AC21)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103547610 (H2AC21) Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103547610 (H2AC21) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103547610 (H2AC21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103547610 NCBI-ProteinID:  XP_008513091 UniProt:  A0ABM2EEY6 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPGKNK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgcggaaagcagggaggcaaagctcgcgccaaggccaagtctcgatcgtcc cgtgctggccttcagtttccggtggggcgagtgcaccgcttgctgcgcaaaggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggcggcagtgctggagtacctgact gcggagatcctggagctggcgggtaacgcggcccgagataataagaagacgcgcatcatc cctcgtcatttgcaactagctgtgagaaatgacgaagagctcaacaagttactcgggggt gtcaccattgcccagggcggcgtcttgcccaatatccaggctgtcttgttgcctaagaaa acggaaagccacaagcctggcaagaacaagtaa

DBGET integrated database retrieval system