Equus przewalskii (Przewalski's horse): 103547830 Help Entry 103547830         CDS       T04644                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04015   Rap1 signaling pathway epz04810   Regulation of actin cytoskeleton epz05014   Amyotrophic lateral sclerosis epz05132   Salmonella infection Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103547830 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103547830 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103547830 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103547830 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:epz04131]     103547830 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:epz04812]     103547830 (PFN4)    04147 Exosome [BR:epz04147]     103547830 (PFN4) Membrane trafficking [BR:epz04131]  Others   Actin-binding proteins    Others     103547830 (PFN4) Cytoskeleton proteins [BR:epz04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103547830 (PFN4) Exosome [BR:epz04147]  Exosomal proteins   Proteins found in most exosomes    103547830 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103547830 NCBI-ProteinID:  XP_008513511 LinkDB All DBs Position 14:71170515..71176710 Genome browser AA seq 129 aa AA seqDB search MSHLHNLLLDTLLGTKHVDSAALIKIQERSLTVASPGFSVMPCDVRTLVNGFAKNPLQAR REGLYFREKDYKCVRADDHSLYAKNENTGVVVVKTHVYLLVATYIEGMYPSVCVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcacaacttactgttagataccctcctgggaacgaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcctgactgtagcatcaccaggatttagtgta atgccctgtgatgtccgaacacttgtgaatggattcgccaagaaccccttgcaagccaga agagaagggttgtatttcagggaaaaagactacaaatgtgtccgggcagatgaccattct ctttatgctaagaatgaaaacactggtgtggtggttgtgaagactcatgtgtatcttctg gtggcaacatacattgagggcatgtatcctagtgtttgtgtggaagccacagagaagctg ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system