Equus przewalskii (Przewalski's horse): 103547920 Help Entry 103547920         CDS       T04644                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04382   Cornified envelope formation epz05132   Salmonella infection Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103547920 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103547920 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103547920 (S100A10) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of microglial cells    103547920 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  103547920 NCBI-ProteinID:  XP_008513643 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaacaatgatgttcacatttcacaaatttgct ggggataaaggctacttaacaaaggaagacctgagagtactcatggaaaaggagttcccc ggatttttggaaaatcaaaaagaccctctggccgtggacaagataatgaaggacctggac cagtgccgagacggcaaagtgggcttccagagcttcttttcgctaattgccgggctcacc atcgcatgcaatgactattttgtagtacacatgaagcagaagggaagaaagtag

DBGET integrated database retrieval system