Equus przewalskii (Przewalski's horse): 103548885 Help Entry 103548885         CDS       T04644                                  Symbol CALML5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04014   Ras signaling pathway epz04015   Rap1 signaling pathway epz04020   Calcium signaling pathway epz04022   cGMP-PKG signaling pathway epz04024   cAMP signaling pathway epz04070   Phosphatidylinositol signaling system epz04114   Oocyte meiosis epz04218   Cellular senescence epz04261   Adrenergic signaling in cardiomyocytes epz04270   Vascular smooth muscle contraction epz04371   Apelin signaling pathway epz04625   C-type lectin receptor signaling pathway epz04713   Circadian entrainment epz04720   Long-term potentiation epz04722   Neurotrophin signaling pathway epz04728   Dopaminergic synapse epz04740   Olfactory transduction epz04744   Phototransduction epz04750   Inflammatory mediator regulation of TRP channels epz04910   Insulin signaling pathway epz04912   GnRH signaling pathway epz04915   Estrogen signaling pathway epz04916   Melanogenesis epz04921   Oxytocin signaling pathway epz04922   Glucagon signaling pathway epz04924   Renin secretion epz04925   Aldosterone synthesis and secretion epz04970   Salivary secretion epz04971   Gastric acid secretion epz05010   Alzheimer disease epz05012   Parkinson disease epz05022   Pathways of neurodegeneration - multiple diseases epz05031   Amphetamine addiction epz05034   Alcoholism epz05133   Pertussis epz05152   Tuberculosis epz05163   Human cytomegalovirus infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05170   Human immunodeficiency virus 1 infection epz05200   Pathways in cancer epz05214   Glioma epz05417   Lipid and atherosclerosis epz05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103548885 (CALML5)    04015 Rap1 signaling pathway     103548885 (CALML5)    04371 Apelin signaling pathway     103548885 (CALML5)    04020 Calcium signaling pathway     103548885 (CALML5)    04070 Phosphatidylinositol signaling system     103548885 (CALML5)    04024 cAMP signaling pathway     103548885 (CALML5)    04022 cGMP-PKG signaling pathway     103548885 (CALML5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103548885 (CALML5)    04218 Cellular senescence     103548885 (CALML5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103548885 (CALML5)   09152 Endocrine system    04910 Insulin signaling pathway     103548885 (CALML5)    04922 Glucagon signaling pathway     103548885 (CALML5)    04912 GnRH signaling pathway     103548885 (CALML5)    04915 Estrogen signaling pathway     103548885 (CALML5)    04921 Oxytocin signaling pathway     103548885 (CALML5)    04916 Melanogenesis     103548885 (CALML5)    04924 Renin secretion     103548885 (CALML5)    04925 Aldosterone synthesis and secretion     103548885 (CALML5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103548885 (CALML5)    04270 Vascular smooth muscle contraction     103548885 (CALML5)   09154 Digestive system    04970 Salivary secretion     103548885 (CALML5)    04971 Gastric acid secretion     103548885 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     103548885 (CALML5)    04720 Long-term potentiation     103548885 (CALML5)    04722 Neurotrophin signaling pathway     103548885 (CALML5)   09157 Sensory system    04744 Phototransduction     103548885 (CALML5)    04740 Olfactory transduction     103548885 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     103548885 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     103548885 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103548885 (CALML5)   09162 Cancer: specific types    05214 Glioma     103548885 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103548885 (CALML5)    05163 Human cytomegalovirus infection     103548885 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     103548885 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     103548885 (CALML5)    05152 Tuberculosis     103548885 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     103548885 (CALML5)    05012 Parkinson disease     103548885 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     103548885 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     103548885 (CALML5)    05034 Alcoholism     103548885 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103548885 (CALML5)    05418 Fluid shear stress and atherosclerosis     103548885 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:epz01009]     103548885 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:epz04131]     103548885 (CALML5)    03036 Chromosome and associated proteins [BR:epz03036]     103548885 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103548885 (CALML5) Protein phosphatases and associated proteins [BR:epz01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103548885 (CALML5) Membrane trafficking [BR:epz04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103548885 (CALML5) Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103548885 (CALML5) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103548885 (CALML5) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_FSTL1 Allatotropin-like_C EF-hand_9 EH SPARC_Ca_bdg Dockerin_1 DUF5580_M CFAP251_C EF_SSP120 EF_EFCAB10_C EF-hand_EFHB_C EF-hand_STIM1 TerB SPM SAPC2_N SurA_N_3 RNase_H Motif Other DBs NCBI-GeneID:  103548885 NCBI-ProteinID:  XP_008515096 UniProt:  A0ABM2EWL4 LinkDB All DBs Position 30:27291606..27292371 Genome browser AA seq 149 aa AA seqDB search MAEKLSEEQVAEFKEAFSSVDKNGDGTINTQELGAVMQALGHSLSEAELNELIARVDSDG DGVINFQEFLAEMVKRRKAWGSEQDLQGVFRAFDLDGDGHINVDELKQAIGKLGDEVSEE ALEVMIRQADLDQDGKVSYEEFVRILTQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgagaagctgtctgaagagcaggtggccgagttcaaggaggccttctccagtgtt gacaagaatggggatggcaccatcaacacccaggagctgggcgccgtgatgcaggccttg ggccacagtctgtcggaggccgagttgaacgagctcatcgccagggtggactctgatggc gatggcgtcatcaacttccaagagttcctggcggagatggtcaagaggaggaaggcctgg ggcagtgagcaggacctgcagggggtcttccgtgcctttgacctggacggtgacggccac atcaacgtggatgagctcaagcaggccataggcaagctaggggatgaggtttccgaggag gcgctggaagtcatgatccgccaggctgacttggaccaggacgggaaggtgagctacgag gagttcgtgcgcatcctcacccagaagtga

DBGET integrated database retrieval system