Equus przewalskii (Przewalski's horse): 103548886 Help Entry 103548886         CDS       T04644                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04014   Ras signaling pathway epz04015   Rap1 signaling pathway epz04020   Calcium signaling pathway epz04022   cGMP-PKG signaling pathway epz04024   cAMP signaling pathway epz04070   Phosphatidylinositol signaling system epz04114   Oocyte meiosis epz04218   Cellular senescence epz04261   Adrenergic signaling in cardiomyocytes epz04270   Vascular smooth muscle contraction epz04371   Apelin signaling pathway epz04625   C-type lectin receptor signaling pathway epz04713   Circadian entrainment epz04720   Long-term potentiation epz04722   Neurotrophin signaling pathway epz04728   Dopaminergic synapse epz04740   Olfactory transduction epz04744   Phototransduction epz04750   Inflammatory mediator regulation of TRP channels epz04910   Insulin signaling pathway epz04912   GnRH signaling pathway epz04915   Estrogen signaling pathway epz04916   Melanogenesis epz04921   Oxytocin signaling pathway epz04922   Glucagon signaling pathway epz04924   Renin secretion epz04925   Aldosterone synthesis and secretion epz04970   Salivary secretion epz04971   Gastric acid secretion epz05010   Alzheimer disease epz05012   Parkinson disease epz05022   Pathways of neurodegeneration - multiple diseases epz05031   Amphetamine addiction epz05034   Alcoholism epz05133   Pertussis epz05152   Tuberculosis epz05163   Human cytomegalovirus infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05170   Human immunodeficiency virus 1 infection epz05200   Pathways in cancer epz05214   Glioma epz05417   Lipid and atherosclerosis epz05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103548886    04015 Rap1 signaling pathway     103548886    04371 Apelin signaling pathway     103548886    04020 Calcium signaling pathway     103548886    04070 Phosphatidylinositol signaling system     103548886    04024 cAMP signaling pathway     103548886    04022 cGMP-PKG signaling pathway     103548886  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103548886    04218 Cellular senescence     103548886  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103548886   09152 Endocrine system    04910 Insulin signaling pathway     103548886    04922 Glucagon signaling pathway     103548886    04912 GnRH signaling pathway     103548886    04915 Estrogen signaling pathway     103548886    04921 Oxytocin signaling pathway     103548886    04916 Melanogenesis     103548886    04924 Renin secretion     103548886    04925 Aldosterone synthesis and secretion     103548886   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103548886    04270 Vascular smooth muscle contraction     103548886   09154 Digestive system    04970 Salivary secretion     103548886    04971 Gastric acid secretion     103548886   09156 Nervous system    04728 Dopaminergic synapse     103548886    04720 Long-term potentiation     103548886    04722 Neurotrophin signaling pathway     103548886   09157 Sensory system    04744 Phototransduction     103548886    04740 Olfactory transduction     103548886    04750 Inflammatory mediator regulation of TRP channels     103548886   09159 Environmental adaptation    04713 Circadian entrainment     103548886  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103548886   09162 Cancer: specific types    05214 Glioma     103548886   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103548886    05163 Human cytomegalovirus infection     103548886    05167 Kaposi sarcoma-associated herpesvirus infection     103548886   09171 Infectious disease: bacterial    05133 Pertussis     103548886    05152 Tuberculosis     103548886   09164 Neurodegenerative disease    05010 Alzheimer disease     103548886    05012 Parkinson disease     103548886    05022 Pathways of neurodegeneration - multiple diseases     103548886   09165 Substance dependence    05031 Amphetamine addiction     103548886    05034 Alcoholism     103548886   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103548886    05418 Fluid shear stress and atherosclerosis     103548886  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:epz01009]     103548886   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:epz04131]     103548886    03036 Chromosome and associated proteins [BR:epz03036]     103548886   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103548886 Protein phosphatases and associated proteins [BR:epz01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103548886 Membrane trafficking [BR:epz04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103548886 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103548886 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103548886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C DUF5580_M EFhand_Ca_insen Caleosin Dockerin_1 FCaBP_EF-hand EF-hand_11 EH Latarcin EF-hand_EFHB_C EF-hand_STIM1 EF-hand_SWAP70_N Motif Other DBs NCBI-GeneID:  103548886 NCBI-ProteinID:  XP_008515097 UniProt:  A0ABM2EHV5 LinkDB All DBs Position 30:complement(27266062..27267518) Genome browser AA seq 149 aa AA seqDB search MADELTEEQVAVFMEAFALFDKDGDGIITTQELGTVMRSLGQSPTEAELQGMVSKVDHDG NRTVDFPEFLDMMAKKMKDRDSEEEIREAFRMFDKDGNGFISTAELRHMTTRLGEKLTKE EVDKMIRAADVDGDGQVNYEEFVRMLVPK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatgagctgacagaggagcaggtggccgtcttcatggaggccttcgccctgttc gacaaggatggggatggcatcatcaccacccaggagctgggcactgtcatgcggtcccta ggccagagccccacagaggccgagctacagggcatggtgagcaaggtcgaccatgacggc aacaggaccgtggacttccctgagttcctggacatgatggccaagaagatgaaggacagg gacagtgaggaagagatccgggaggccttccgcatgttcgacaaggatggcaacggcttc atcagcacggctgagctacggcacatgacaaccaggctgggagagaagctgaccaaagag gaggtggacaagatgatccgggcagccgatgtggatggggatgggcaggtgaactatgag gagttcgtccgcatgctggtccccaagtga

DBGET integrated database retrieval system