Equus przewalskii (Przewalski's horse): 103552460 Help Entry 103552460         CDS       T04644                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04010   MAPK signaling pathway epz04020   Calcium signaling pathway epz04022   cGMP-PKG signaling pathway epz04114   Oocyte meiosis epz04218   Cellular senescence epz04310   Wnt signaling pathway epz04360   Axon guidance epz04370   VEGF signaling pathway epz04380   Osteoclast differentiation epz04625   C-type lectin receptor signaling pathway epz04650   Natural killer cell mediated cytotoxicity epz04658   Th1 and Th2 cell differentiation epz04659   Th17 cell differentiation epz04660   T cell receptor signaling pathway epz04662   B cell receptor signaling pathway epz04720   Long-term potentiation epz04724   Glutamatergic synapse epz04921   Oxytocin signaling pathway epz04922   Glucagon signaling pathway epz04924   Renin secretion epz05010   Alzheimer disease epz05014   Amyotrophic lateral sclerosis epz05020   Prion disease epz05022   Pathways of neurodegeneration - multiple diseases epz05031   Amphetamine addiction epz05152   Tuberculosis epz05163   Human cytomegalovirus infection epz05166   Human T-cell leukemia virus 1 infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05170   Human immunodeficiency virus 1 infection epz05235   PD-L1 expression and PD-1 checkpoint pathway in cancer epz05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103552460 (PPP3R2)    04310 Wnt signaling pathway     103552460 (PPP3R2)    04370 VEGF signaling pathway     103552460 (PPP3R2)    04020 Calcium signaling pathway     103552460 (PPP3R2)    04022 cGMP-PKG signaling pathway     103552460 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103552460 (PPP3R2)    04218 Cellular senescence     103552460 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103552460 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     103552460 (PPP3R2)    04660 T cell receptor signaling pathway     103552460 (PPP3R2)    04658 Th1 and Th2 cell differentiation     103552460 (PPP3R2)    04659 Th17 cell differentiation     103552460 (PPP3R2)    04662 B cell receptor signaling pathway     103552460 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     103552460 (PPP3R2)    04921 Oxytocin signaling pathway     103552460 (PPP3R2)    04924 Renin secretion     103552460 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     103552460 (PPP3R2)    04720 Long-term potentiation     103552460 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     103552460 (PPP3R2)    04380 Osteoclast differentiation     103552460 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103552460 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103552460 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     103552460 (PPP3R2)    05163 Human cytomegalovirus infection     103552460 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     103552460 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     103552460 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     103552460 (PPP3R2)    05014 Amyotrophic lateral sclerosis     103552460 (PPP3R2)    05020 Prion disease     103552460 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     103552460 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     103552460 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103552460 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:epz01009]     103552460 (PPP3R2) Protein phosphatases and associated proteins [BR:epz01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103552460 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Pam3_gp18 YtfJ_HI0045 RST Motif Other DBs NCBI-GeneID:  103552460 NCBI-ProteinID:  XP_008520688 LinkDB All DBs Position 26:complement(7861803..7862851) Genome browser AA seq 171 aa AA seqDB search MGNEASYPEEMCSQFDHDEIKRLSKRFKKLDLDNSGSLSVDEFLSLPQLQRNPLAKRVID VFDTDGNGVVDFKEFIVGTSQFSVKGSEEQKLRFAFSIYDMDKDGYISNGELFQVLKLMV GDDTLTDWELQEVVDKTIICLDTDGDGKISYEEFSAVVRGLEIHKNLVVAV NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atggggaatgaggccagttacccggaggaaatgtgctcccagtttgaccatgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggacaattcgggctctctgagcgtg gatgagttcctgtcgctgccccagctgcagcggaatccgttggcgaagagagtgatcgac gtcttcgacaccgacggcaatggcgtagtggacttcaaggaattcatcgtggggacctcc cagttcagtgtcaagggcagcgaggagcagaagctaaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggagagctcttccaggtgctgaagttgatggtg ggggacgacaccctgacagactgggagttacaggaggtcgtcgacaaaaccatcatctgc ctggatacagacggcgatgggaaaatatcctacgaggaattcagcgctgtggtccgaggc ctggagatccacaagaacttggtggtggctgtgtga

DBGET integrated database retrieval system