Equus przewalskii (Przewalski's horse): 103552675 Help Entry 103552675         CDS       T04644                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz01521   EGFR tyrosine kinase inhibitor resistance epz01522   Endocrine resistance epz04010   MAPK signaling pathway epz04012   ErbB signaling pathway epz04014   Ras signaling pathway epz04015   Rap1 signaling pathway epz04062   Chemokine signaling pathway epz04068   FoxO signaling pathway epz04071   Sphingolipid signaling pathway epz04072   Phospholipase D signaling pathway epz04137   Mitophagy - animal epz04140   Autophagy - animal epz04150   mTOR signaling pathway epz04151   PI3K-Akt signaling pathway epz04210   Apoptosis epz04211   Longevity regulating pathway epz04213   Longevity regulating pathway - multiple species epz04218   Cellular senescence epz04360   Axon guidance epz04370   VEGF signaling pathway epz04371   Apelin signaling pathway epz04540   Gap junction epz04550   Signaling pathways regulating pluripotency of stem cells epz04625   C-type lectin receptor signaling pathway epz04650   Natural killer cell mediated cytotoxicity epz04660   T cell receptor signaling pathway epz04662   B cell receptor signaling pathway epz04664   Fc epsilon RI signaling pathway epz04714   Thermogenesis epz04720   Long-term potentiation epz04722   Neurotrophin signaling pathway epz04725   Cholinergic synapse epz04726   Serotonergic synapse epz04730   Long-term depression epz04810   Regulation of actin cytoskeleton epz04910   Insulin signaling pathway epz04912   GnRH signaling pathway epz04915   Estrogen signaling pathway epz04916   Melanogenesis epz04917   Prolactin signaling pathway epz04919   Thyroid hormone signaling pathway epz04921   Oxytocin signaling pathway epz04926   Relaxin signaling pathway epz04929   GnRH secretion epz04933   AGE-RAGE signaling pathway in diabetic complications epz04935   Growth hormone synthesis, secretion and action epz05010   Alzheimer disease epz05022   Pathways of neurodegeneration - multiple diseases epz05034   Alcoholism epz05160   Hepatitis C epz05161   Hepatitis B epz05163   Human cytomegalovirus infection epz05165   Human papillomavirus infection epz05166   Human T-cell leukemia virus 1 infection epz05167   Kaposi sarcoma-associated herpesvirus infection epz05170   Human immunodeficiency virus 1 infection epz05200   Pathways in cancer epz05203   Viral carcinogenesis epz05205   Proteoglycans in cancer epz05206   MicroRNAs in cancer epz05207   Chemical carcinogenesis - receptor activation epz05208   Chemical carcinogenesis - reactive oxygen species epz05210   Colorectal cancer epz05211   Renal cell carcinoma epz05213   Endometrial cancer epz05214   Glioma epz05215   Prostate cancer epz05216   Thyroid cancer epz05218   Melanoma epz05219   Bladder cancer epz05220   Chronic myeloid leukemia epz05221   Acute myeloid leukemia epz05223   Non-small cell lung cancer epz05224   Breast cancer epz05225   Hepatocellular carcinoma epz05226   Gastric cancer epz05230   Central carbon metabolism in cancer epz05231   Choline metabolism in cancer epz05235   PD-L1 expression and PD-1 checkpoint pathway in cancer epz05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103552675 (NRAS)    04012 ErbB signaling pathway     103552675 (NRAS)    04014 Ras signaling pathway     103552675 (NRAS)    04015 Rap1 signaling pathway     103552675 (NRAS)    04370 VEGF signaling pathway     103552675 (NRAS)    04371 Apelin signaling pathway     103552675 (NRAS)    04068 FoxO signaling pathway     103552675 (NRAS)    04072 Phospholipase D signaling pathway     103552675 (NRAS)    04071 Sphingolipid signaling pathway     103552675 (NRAS)    04151 PI3K-Akt signaling pathway     103552675 (NRAS)    04150 mTOR signaling pathway     103552675 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103552675 (NRAS)    04137 Mitophagy - animal     103552675 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103552675 (NRAS)    04218 Cellular senescence     103552675 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103552675 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103552675 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103552675 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103552675 (NRAS)    04650 Natural killer cell mediated cytotoxicity     103552675 (NRAS)    04660 T cell receptor signaling pathway     103552675 (NRAS)    04662 B cell receptor signaling pathway     103552675 (NRAS)    04664 Fc epsilon RI signaling pathway     103552675 (NRAS)    04062 Chemokine signaling pathway     103552675 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103552675 (NRAS)    04929 GnRH secretion     103552675 (NRAS)    04912 GnRH signaling pathway     103552675 (NRAS)    04915 Estrogen signaling pathway     103552675 (NRAS)    04917 Prolactin signaling pathway     103552675 (NRAS)    04921 Oxytocin signaling pathway     103552675 (NRAS)    04926 Relaxin signaling pathway     103552675 (NRAS)    04935 Growth hormone synthesis, secretion and action     103552675 (NRAS)    04919 Thyroid hormone signaling pathway     103552675 (NRAS)    04916 Melanogenesis     103552675 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     103552675 (NRAS)    04726 Serotonergic synapse     103552675 (NRAS)    04720 Long-term potentiation     103552675 (NRAS)    04730 Long-term depression     103552675 (NRAS)    04722 Neurotrophin signaling pathway     103552675 (NRAS)   09158 Development and regeneration    04360 Axon guidance     103552675 (NRAS)   09149 Aging    04211 Longevity regulating pathway     103552675 (NRAS)    04213 Longevity regulating pathway - multiple species     103552675 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     103552675 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103552675 (NRAS)    05206 MicroRNAs in cancer     103552675 (NRAS)    05205 Proteoglycans in cancer     103552675 (NRAS)    05207 Chemical carcinogenesis - receptor activation     103552675 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     103552675 (NRAS)    05203 Viral carcinogenesis     103552675 (NRAS)    05230 Central carbon metabolism in cancer     103552675 (NRAS)    05231 Choline metabolism in cancer     103552675 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103552675 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103552675 (NRAS)    05225 Hepatocellular carcinoma     103552675 (NRAS)    05226 Gastric cancer     103552675 (NRAS)    05214 Glioma     103552675 (NRAS)    05216 Thyroid cancer     103552675 (NRAS)    05221 Acute myeloid leukemia     103552675 (NRAS)    05220 Chronic myeloid leukemia     103552675 (NRAS)    05218 Melanoma     103552675 (NRAS)    05211 Renal cell carcinoma     103552675 (NRAS)    05219 Bladder cancer     103552675 (NRAS)    05215 Prostate cancer     103552675 (NRAS)    05213 Endometrial cancer     103552675 (NRAS)    05224 Breast cancer     103552675 (NRAS)    05223 Non-small cell lung cancer     103552675 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103552675 (NRAS)    05170 Human immunodeficiency virus 1 infection     103552675 (NRAS)    05161 Hepatitis B     103552675 (NRAS)    05160 Hepatitis C     103552675 (NRAS)    05163 Human cytomegalovirus infection     103552675 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103552675 (NRAS)    05165 Human papillomavirus infection     103552675 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103552675 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     103552675 (NRAS)   09165 Substance dependence    05034 Alcoholism     103552675 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103552675 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103552675 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103552675 (NRAS)    01522 Endocrine resistance     103552675 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:epz04131]     103552675 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103552675 (NRAS)    04031 GTP-binding proteins [BR:epz04031]     103552675 (NRAS) Membrane trafficking [BR:epz04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103552675 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103552675 (NRAS) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103552675 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103552675 (NRAS)   Exosomal proteins of breast cancer cells    103552675 (NRAS)   Exosomal proteins of colorectal cancer cells    103552675 (NRAS) GTP-binding proteins [BR:epz04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103552675 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103552675 NCBI-ProteinID:  XP_008521053 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttggaaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggctaagagttatgggattccg ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggtg agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system