Equus przewalskii (Przewalski's horse): 103553409 Help Entry 103553409         CDS       T04644                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04014   Ras signaling pathway epz04015   Rap1 signaling pathway epz04022   cGMP-PKG signaling pathway epz04024   cAMP signaling pathway epz04062   Chemokine signaling pathway epz04071   Sphingolipid signaling pathway epz04072   Phospholipase D signaling pathway epz04081   Hormone signaling epz04144   Endocytosis epz04150   mTOR signaling pathway epz04270   Vascular smooth muscle contraction epz04310   Wnt signaling pathway epz04350   TGF-beta signaling pathway epz04360   Axon guidance epz04510   Focal adhesion epz04517   IgSF CAM signaling epz04520   Adherens junction epz04530   Tight junction epz04611   Platelet activation epz04621   NOD-like receptor signaling pathway epz04625   C-type lectin receptor signaling pathway epz04660   T cell receptor signaling pathway epz04670   Leukocyte transendothelial migration epz04722   Neurotrophin signaling pathway epz04810   Regulation of actin cytoskeleton epz04921   Oxytocin signaling pathway epz04928   Parathyroid hormone synthesis, secretion and action epz04972   Pancreatic secretion epz05100   Bacterial invasion of epithelial cells epz05132   Salmonella infection epz05133   Pertussis epz05135   Yersinia infection epz05152   Tuberculosis epz05163   Human cytomegalovirus infection epz05200   Pathways in cancer epz05203   Viral carcinogenesis epz05205   Proteoglycans in cancer epz05206   MicroRNAs in cancer epz05210   Colorectal cancer epz05417   Lipid and atherosclerosis epz05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103553409 (RHOA)    04015 Rap1 signaling pathway     103553409 (RHOA)    04310 Wnt signaling pathway     103553409 (RHOA)    04350 TGF-beta signaling pathway     103553409 (RHOA)    04072 Phospholipase D signaling pathway     103553409 (RHOA)    04071 Sphingolipid signaling pathway     103553409 (RHOA)    04024 cAMP signaling pathway     103553409 (RHOA)    04022 cGMP-PKG signaling pathway     103553409 (RHOA)    04150 mTOR signaling pathway     103553409 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103553409 (RHOA)    04517 IgSF CAM signaling     103553409 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103553409 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103553409 (RHOA)    04520 Adherens junction     103553409 (RHOA)    04530 Tight junction     103553409 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103553409 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103553409 (RHOA)    04621 NOD-like receptor signaling pathway     103553409 (RHOA)    04625 C-type lectin receptor signaling pathway     103553409 (RHOA)    04660 T cell receptor signaling pathway     103553409 (RHOA)    04670 Leukocyte transendothelial migration     103553409 (RHOA)    04062 Chemokine signaling pathway     103553409 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     103553409 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     103553409 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103553409 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     103553409 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103553409 (RHOA)   09158 Development and regeneration    04360 Axon guidance     103553409 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103553409 (RHOA)    05206 MicroRNAs in cancer     103553409 (RHOA)    05205 Proteoglycans in cancer     103553409 (RHOA)    05203 Viral carcinogenesis     103553409 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     103553409 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103553409 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103553409 (RHOA)    05135 Yersinia infection     103553409 (RHOA)    05133 Pertussis     103553409 (RHOA)    05152 Tuberculosis     103553409 (RHOA)    05100 Bacterial invasion of epithelial cells     103553409 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103553409 (RHOA)    05418 Fluid shear stress and atherosclerosis     103553409 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:epz04131]     103553409 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103553409 (RHOA)    04031 GTP-binding proteins [BR:epz04031]     103553409 (RHOA) Membrane trafficking [BR:epz04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103553409 (RHOA) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103553409 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    103553409 (RHOA)   Exosomal proteins of colorectal cancer cells    103553409 (RHOA)   Exosomal proteins of bladder cancer cells    103553409 (RHOA) GTP-binding proteins [BR:epz04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103553409 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103553409 NCBI-ProteinID:  XP_070431426 UniProt:  A0ABM4KTB1 LinkDB All DBs Position 15:39237027..39292681 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactcgtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacggtgtttgag aactatgtggcagatatcgaagtggatgggaagcaggtagagttagctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccagacaccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact cctgaagtcaagcatttctgtcccaacgtgcccatcatcctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctccaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system