Equus przewalskii (Przewalski's horse): 103554834 Help Entry 103554834         CDS       T04644                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04022   cGMP-PKG signaling pathway epz04081   Hormone signaling epz04270   Vascular smooth muscle contraction epz05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     103554834 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     103554834 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     103554834 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103554834 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:epz04052]     103554834 (NPPC) Cytokines and neuropeptides [BR:epz04052]  Neuropeptides   Unclassified    103554834 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  103554834 NCBI-ProteinID:  XP_070474657 LinkDB All DBs Position 5:complement(19009733..19014684) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRGAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctgctctcgctccggccc tctgaagccaagcctggggcgccgccgaaggtcccgcgaactccgccgggggaggagctg gccgagccccaggctgcgggcggtggacagaagaagggcgacaagacccctggaggcggc ggcgccaacctcaagggcgaccggtctcgactgctccgggacctgcgcgtggacaccaag tcgcggggggcgtgggcccgccttctgcacgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system