Equus przewalskii (Przewalski's horse): 103556158 Help Entry 103556158         CDS       T04644                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05202   Transcriptional misregulation in cancer epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103556158  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103556158   09163 Immune disease    05322 Systemic lupus erythematosus     103556158   09165 Substance dependence    05034 Alcoholism     103556158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103556158   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103556158 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103556158 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103556158 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  103556158 NCBI-ProteinID:  XP_070440345 UniProt:  A0ABM4LIV4 LinkDB All DBs Position 19:complement(24243419..24244672) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcactaagcagacagctcgtaagtccaccggcggcaaggcgccgcgcaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtgaagaagccccac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgatctgcgcttccagagttcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctcgcgcgccgcatccgcggggagagggcataa

DBGET integrated database retrieval system