Equus przewalskii (Przewalski's horse): 103560570 Help Entry 103560570         CDS       T04644                                  Symbol H2AZ1 Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz03082   ATP-dependent chromatin remodeling epz04217   Necroptosis epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103560570 (H2AZ1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103560570 (H2AZ1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103560570 (H2AZ1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     103560570 (H2AZ1)   09165 Substance dependence    05034 Alcoholism     103560570 (H2AZ1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103560570 (H2AZ1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103560570 (H2AZ1) Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103560570 (H2AZ1) Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103560570 (H2AZ1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103560570 NCBI-ProteinID:  XP_070468706 UniProt:  A0ABM4NUU3 LinkDB All DBs Position 3:39461274..39463970 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggtaaggctgggaaggactccggaaaggccaagacaaaggcggtttcccgc tcgcagagggccggcttgcagttcccggtgggccgtattcatcgacacctgaaatctagg acgaccagccatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag tacctcaccgcagaggtacttgaattggcaggaaatgcatcaaaagacttgaaggtaaag cgcattactcctcgtcacttgcaacttgctattcgtggagatgaagaattggactctctc atcaaggctacaattgctggtggtggtgtcattccacacatccacaagtctctgattggg aagaaaggacagcagaagactgtctaa

DBGET integrated database retrieval system