Equus przewalskii (Przewalski's horse): 103560826 Help Entry 103560826         CDS       T04644                                  Name (RefSeq) H2B.U histone 2   KO K11252   histone H2B Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05203   Viral carcinogenesis epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103560826  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103560826   09163 Immune disease    05322 Systemic lupus erythematosus     103560826   09165 Substance dependence    05034 Alcoholism     103560826  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103560826   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103560826 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103560826 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103560826 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  103560826 NCBI-ProteinID:  XP_008533333 UniProt:  A0ABM2F9V1 LinkDB All DBs Position 13:92428137..92432068 Genome browser AA seq 126 aa AA seqDB search MPELSRSAPAPKKGSKKAISKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagctctcccgttcggcgccggcgcccaaaaagggctccaaaaaggctattagc aaggcgcagaagaaggacggcaaaaagcgtaagcgcggccgcaaggagagctactccatc tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccagcgaggcctcccgc ctggcgcactacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system