KEGG   Equus przewalskii (Przewalski's horse): 103562408
Entry
103562408         CDS       T04644                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01521  EGFR tyrosine kinase inhibitor resistance
epz01522  Endocrine resistance
epz01524  Platinum drug resistance
epz04010  MAPK signaling pathway
epz04012  ErbB signaling pathway
epz04014  Ras signaling pathway
epz04015  Rap1 signaling pathway
epz04022  cGMP-PKG signaling pathway
epz04024  cAMP signaling pathway
epz04062  Chemokine signaling pathway
epz04066  HIF-1 signaling pathway
epz04068  FoxO signaling pathway
epz04071  Sphingolipid signaling pathway
epz04072  Phospholipase D signaling pathway
epz04114  Oocyte meiosis
epz04140  Autophagy - animal
epz04148  Efferocytosis
epz04150  mTOR signaling pathway
epz04151  PI3K-Akt signaling pathway
epz04210  Apoptosis
epz04218  Cellular senescence
epz04261  Adrenergic signaling in cardiomyocytes
epz04270  Vascular smooth muscle contraction
epz04350  TGF-beta signaling pathway
epz04360  Axon guidance
epz04370  VEGF signaling pathway
epz04371  Apelin signaling pathway
epz04380  Osteoclast differentiation
epz04510  Focal adhesion
epz04517  IgSF CAM signaling
epz04520  Adherens junction
epz04540  Gap junction
epz04550  Signaling pathways regulating pluripotency of stem cells
epz04611  Platelet activation
epz04613  Neutrophil extracellular trap formation
epz04620  Toll-like receptor signaling pathway
epz04621  NOD-like receptor signaling pathway
epz04625  C-type lectin receptor signaling pathway
epz04650  Natural killer cell mediated cytotoxicity
epz04657  IL-17 signaling pathway
epz04658  Th1 and Th2 cell differentiation
epz04659  Th17 cell differentiation
epz04660  T cell receptor signaling pathway
epz04662  B cell receptor signaling pathway
epz04664  Fc epsilon RI signaling pathway
epz04666  Fc gamma R-mediated phagocytosis
epz04668  TNF signaling pathway
epz04713  Circadian entrainment
epz04720  Long-term potentiation
epz04722  Neurotrophin signaling pathway
epz04723  Retrograde endocannabinoid signaling
epz04724  Glutamatergic synapse
epz04725  Cholinergic synapse
epz04726  Serotonergic synapse
epz04730  Long-term depression
epz04810  Regulation of actin cytoskeleton
epz04910  Insulin signaling pathway
epz04912  GnRH signaling pathway
epz04914  Progesterone-mediated oocyte maturation
epz04915  Estrogen signaling pathway
epz04916  Melanogenesis
epz04917  Prolactin signaling pathway
epz04919  Thyroid hormone signaling pathway
epz04921  Oxytocin signaling pathway
epz04926  Relaxin signaling pathway
epz04928  Parathyroid hormone synthesis, secretion and action
epz04929  GnRH secretion
epz04930  Type II diabetes mellitus
epz04933  AGE-RAGE signaling pathway in diabetic complications
epz04934  Cushing syndrome
epz04935  Growth hormone synthesis, secretion and action
epz04960  Aldosterone-regulated sodium reabsorption
epz05010  Alzheimer disease
epz05020  Prion disease
epz05022  Pathways of neurodegeneration - multiple diseases
epz05034  Alcoholism
epz05132  Salmonella infection
epz05133  Pertussis
epz05135  Yersinia infection
epz05140  Leishmaniasis
epz05142  Chagas disease
epz05145  Toxoplasmosis
epz05152  Tuberculosis
epz05160  Hepatitis C
epz05161  Hepatitis B
epz05163  Human cytomegalovirus infection
epz05164  Influenza A
epz05165  Human papillomavirus infection
epz05166  Human T-cell leukemia virus 1 infection
epz05167  Kaposi sarcoma-associated herpesvirus infection
epz05170  Human immunodeficiency virus 1 infection
epz05171  Coronavirus disease - COVID-19
epz05200  Pathways in cancer
epz05203  Viral carcinogenesis
epz05205  Proteoglycans in cancer
epz05206  MicroRNAs in cancer
epz05207  Chemical carcinogenesis - receptor activation
epz05208  Chemical carcinogenesis - reactive oxygen species
epz05210  Colorectal cancer
epz05211  Renal cell carcinoma
epz05212  Pancreatic cancer
epz05213  Endometrial cancer
epz05214  Glioma
epz05215  Prostate cancer
epz05216  Thyroid cancer
epz05218  Melanoma
epz05219  Bladder cancer
epz05220  Chronic myeloid leukemia
epz05221  Acute myeloid leukemia
epz05223  Non-small cell lung cancer
epz05224  Breast cancer
epz05225  Hepatocellular carcinoma
epz05226  Gastric cancer
epz05230  Central carbon metabolism in cancer
epz05231  Choline metabolism in cancer
epz05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
epz05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103562408 (MAPK1)
   04012 ErbB signaling pathway
    103562408 (MAPK1)
   04014 Ras signaling pathway
    103562408 (MAPK1)
   04015 Rap1 signaling pathway
    103562408 (MAPK1)
   04350 TGF-beta signaling pathway
    103562408 (MAPK1)
   04370 VEGF signaling pathway
    103562408 (MAPK1)
   04371 Apelin signaling pathway
    103562408 (MAPK1)
   04668 TNF signaling pathway
    103562408 (MAPK1)
   04066 HIF-1 signaling pathway
    103562408 (MAPK1)
   04068 FoxO signaling pathway
    103562408 (MAPK1)
   04072 Phospholipase D signaling pathway
    103562408 (MAPK1)
   04071 Sphingolipid signaling pathway
    103562408 (MAPK1)
   04024 cAMP signaling pathway
    103562408 (MAPK1)
   04022 cGMP-PKG signaling pathway
    103562408 (MAPK1)
   04151 PI3K-Akt signaling pathway
    103562408 (MAPK1)
   04150 mTOR signaling pathway
    103562408 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    103562408 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103562408 (MAPK1)
   04148 Efferocytosis
    103562408 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103562408 (MAPK1)
   04210 Apoptosis
    103562408 (MAPK1)
   04218 Cellular senescence
    103562408 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103562408 (MAPK1)
   04520 Adherens junction
    103562408 (MAPK1)
   04540 Gap junction
    103562408 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103562408 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103562408 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103562408 (MAPK1)
   04613 Neutrophil extracellular trap formation
    103562408 (MAPK1)
   04620 Toll-like receptor signaling pathway
    103562408 (MAPK1)
   04621 NOD-like receptor signaling pathway
    103562408 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    103562408 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    103562408 (MAPK1)
   04660 T cell receptor signaling pathway
    103562408 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    103562408 (MAPK1)
   04659 Th17 cell differentiation
    103562408 (MAPK1)
   04657 IL-17 signaling pathway
    103562408 (MAPK1)
   04662 B cell receptor signaling pathway
    103562408 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    103562408 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    103562408 (MAPK1)
   04062 Chemokine signaling pathway
    103562408 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103562408 (MAPK1)
   04929 GnRH secretion
    103562408 (MAPK1)
   04912 GnRH signaling pathway
    103562408 (MAPK1)
   04915 Estrogen signaling pathway
    103562408 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    103562408 (MAPK1)
   04917 Prolactin signaling pathway
    103562408 (MAPK1)
   04921 Oxytocin signaling pathway
    103562408 (MAPK1)
   04926 Relaxin signaling pathway
    103562408 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    103562408 (MAPK1)
   04919 Thyroid hormone signaling pathway
    103562408 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    103562408 (MAPK1)
   04916 Melanogenesis
    103562408 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103562408 (MAPK1)
   04270 Vascular smooth muscle contraction
    103562408 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103562408 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103562408 (MAPK1)
   04725 Cholinergic synapse
    103562408 (MAPK1)
   04726 Serotonergic synapse
    103562408 (MAPK1)
   04720 Long-term potentiation
    103562408 (MAPK1)
   04730 Long-term depression
    103562408 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    103562408 (MAPK1)
   04722 Neurotrophin signaling pathway
    103562408 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    103562408 (MAPK1)
   04380 Osteoclast differentiation
    103562408 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103562408 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103562408 (MAPK1)
   05206 MicroRNAs in cancer
    103562408 (MAPK1)
   05205 Proteoglycans in cancer
    103562408 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    103562408 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    103562408 (MAPK1)
   05203 Viral carcinogenesis
    103562408 (MAPK1)
   05230 Central carbon metabolism in cancer
    103562408 (MAPK1)
   05231 Choline metabolism in cancer
    103562408 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103562408 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103562408 (MAPK1)
   05212 Pancreatic cancer
    103562408 (MAPK1)
   05225 Hepatocellular carcinoma
    103562408 (MAPK1)
   05226 Gastric cancer
    103562408 (MAPK1)
   05214 Glioma
    103562408 (MAPK1)
   05216 Thyroid cancer
    103562408 (MAPK1)
   05221 Acute myeloid leukemia
    103562408 (MAPK1)
   05220 Chronic myeloid leukemia
    103562408 (MAPK1)
   05218 Melanoma
    103562408 (MAPK1)
   05211 Renal cell carcinoma
    103562408 (MAPK1)
   05219 Bladder cancer
    103562408 (MAPK1)
   05215 Prostate cancer
    103562408 (MAPK1)
   05213 Endometrial cancer
    103562408 (MAPK1)
   05224 Breast cancer
    103562408 (MAPK1)
   05223 Non-small cell lung cancer
    103562408 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103562408 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    103562408 (MAPK1)
   05161 Hepatitis B
    103562408 (MAPK1)
   05160 Hepatitis C
    103562408 (MAPK1)
   05171 Coronavirus disease - COVID-19
    103562408 (MAPK1)
   05164 Influenza A
    103562408 (MAPK1)
   05163 Human cytomegalovirus infection
    103562408 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103562408 (MAPK1)
   05165 Human papillomavirus infection
    103562408 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103562408 (MAPK1)
   05135 Yersinia infection
    103562408 (MAPK1)
   05133 Pertussis
    103562408 (MAPK1)
   05152 Tuberculosis
    103562408 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103562408 (MAPK1)
   05140 Leishmaniasis
    103562408 (MAPK1)
   05142 Chagas disease
    103562408 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103562408 (MAPK1)
   05020 Prion disease
    103562408 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    103562408 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    103562408 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103562408 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103562408 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103562408 (MAPK1)
   04934 Cushing syndrome
    103562408 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103562408 (MAPK1)
   01524 Platinum drug resistance
    103562408 (MAPK1)
   01522 Endocrine resistance
    103562408 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103562408 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103562408 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103562408 (MAPK1)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103562408 (MAPK1)
Protein kinases [BR:epz01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103562408 (MAPK1)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103562408 (MAPK1)
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103562408 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 103562408
NCBI-ProteinID: XP_070484456
UniProt: A0ABM4Q4U0
LinkDB
Position
7:complement(5035348..5141207)
AA seq 363 aa
MAAAAAAAAACAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKIS
PFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLK
TQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD
HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL
NHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFN
PHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
YRS
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcggcgtgcgcgggcccggagatggtccgcgggcag
gtgttcgacgtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggc
atggtgtgctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagt
ccttttgagcaccagacctactgccagagaaccctgagggagataaaaatcttactgcgc
ttcagacatgagaacatcattggaatcaatgatattattcgagcgccaaccatcgagcaa
atgaaagatgtatatatagtacaggacctcatggaaacggatctctacaaactcttgaag
acccaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagctaacgtactgcatcgtgacctcaaaccttccaacctgctgctc
aataccacctgtgatctcaagatctgtgactttggcttggcccgtgttgcagatccggac
catgatcacacagggttcctgacggagtatgtagccacgcgttggtacagggctccagaa
attatgttgaattccaagggctataccaagtccattgatatttggtctgtaggctgcatt
ctggcagagatgctctccaacaggcctatcttcccggggaagcattatcttgaccagctg
aaccacattctgggtattcttggatccccatcacaggaagacctgaattgtataataaat
ttaaaagctagaaactatttgctttctcttccacacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctcgacttgctggacaaaatgttgacattcaac
cctcacaagaggatcgaagtagagcaggctctggcccacccgtacctggagcagtactat
gacccgagtgacgagcccatcgctgaagcaccattcaagtttgacatggaattggatgat
ttgcccaaggaaaagctcaaagaactcatttttgaagagactgctagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system