Equus przewalskii (Przewalski's horse): 103562558 Help Entry 103562558         CDS       T04644                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04613   Neutrophil extracellular trap formation epz05034   Alcoholism epz05202   Transcriptional misregulation in cancer epz05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103562558  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103562558   09163 Immune disease    05322 Systemic lupus erythematosus     103562558   09165 Substance dependence    05034 Alcoholism     103562558  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:epz03036]     103562558   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:epz04147]     103562558 Chromosome and associated proteins [BR:epz03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103562558 Exosome [BR:epz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103562558 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  103562558 NCBI-ProteinID:  XP_008535873 UniProt:  A0ABM2FDA3 LinkDB All DBs Position 5:complement(85283361..85283906) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagccccgaggaagcag ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacgatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system