Equus przewalskii (Przewalski's horse): 103563312 Help Entry 103563312         CDS       T04644                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04015   Rap1 signaling pathway epz04810   Regulation of actin cytoskeleton epz05014   Amyotrophic lateral sclerosis epz05132   Salmonella infection Brite KEGG Orthology (KO) [BR:epz00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103563312 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103563312 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103563312 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103563312 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:epz04131]     103563312 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:epz04812]     103563312 (PFN2)    04147 Exosome [BR:epz04147]     103563312 (PFN2) Membrane trafficking [BR:epz04131]  Others   Actin-binding proteins    Others     103563312 (PFN2) Cytoskeleton proteins [BR:epz04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103563312 (PFN2) Exosome [BR:epz04147]  Exosomal proteins   Proteins found in most exosomes    103563312 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103563312 NCBI-ProteinID:  XP_070432427 LinkDB All DBs Position 15:complement(84274548..84280164) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtgtgggccgccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacgatggacatccggacgaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system