Equus przewalskii (Przewalski's horse): 103564200 Help Entry 103564200         CDS       T04644                                  Name (RefSeq) metallothionein-1A   KO K14739   metallothionein 1/2 Organism epz  Equus przewalskii (Przewalski's horse) Pathway epz04978   Mineral absorption Brite KEGG Orthology (KO) [BR:epz00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     103564200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:epz03019]     103564200    03029 Mitochondrial biogenesis [BR:epz03029]     103564200 Messenger RNA biogenesis [BR:epz03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103564200 Mitochondrial biogenesis [BR:epz03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     103564200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  103564200 NCBI-ProteinID:  XP_008538012 LinkDB All DBs Position 3:8864177..8866379 Genome browser AA seq 61 aa AA seqDB search MDPNCSCPTGGSCTCAGSCKCKECRCTSCKKSCCSCCPGGCARCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcgtgccccactggtggctcctgcacctgtgccggctcctgcaag tgcaaagagtgcagatgcacctcctgcaagaagagctgctgctcctgctgccccgggggc tgtgccaggtgtgcccagggctgcgtctgcaaaggggcatcggacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system